PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10027459
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 289aa    MW: 31744.5 Da    PI: 5.7349
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10027459genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEde+l d++++ G g+W+t ++  g+ R++k+c++rw +yl
      Lus10027459 14 RGAWSAEEDEILSDYINKNGHGSWRTLPQNAGLLRCGKSCRLRWTNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding48.91.6e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE+  +v + + lG++ W++Ia+ ++ gRt++++k++w+++l
      Lus10027459  67 RGPFSPEEESTIVGLQATLGNK-WASIASQLP-GRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.4E-23564IPR009057Homeodomain-like
PROSITE profilePS5129415.078961IPR017930Myb domain
SuperFamilySSF466892.17E-2811108IPR009057Homeodomain-like
SMARTSM007175.1E-121363IPR001005SANT/Myb domain
PfamPF002492.1E-141461IPR001005SANT/Myb domain
CDDcd001671.88E-91661No hitNo description
PROSITE profilePS5129423.16562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2565115IPR009057Homeodomain-like
SMARTSM007175.0E-1466114IPR001005SANT/Myb domain
PfamPF002493.6E-1467112IPR001005SANT/Myb domain
CDDcd001672.97E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MGRSPCCDKN GVKRGAWSAE EDEILSDYIN KNGHGSWRTL PQNAGLLRCG KSCRLRWTNY  60
LRPDIKRGPF SPEEESTIVG LQATLGNKWA SIASQLPGRT DNEIKNYWNT HLRKRFPAPL  120
PKQAALNKVE AWQASMDESS SMLLTNTPPP PPSSPVHQNF AKDHYLELWY SDVGESFRNI  180
KVKCESSNSQ VSSFSKLGSG SVDDTLATMT ATLTTATTNL VDSTNMMAGP KPGLDGMVSS  240
SDSINSNEFT NYSDTALKQL LAMPGGNSVM EFLDDDVVFT NFPDFRCD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-23141167108B-MYB
1h8a_C1e-221411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1744440.0JX174444.1 Linum usitatissimum clone LuBAC317I7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012090267.13e-98PREDICTED: transcription factor MYB3-like
SwissprotO222644e-59MYB12_ARATH; Transcription factor MYB12
TrEMBLI6XNB80.0I6XNB8_LINUS; Uncharacterized protein
STRINGPOPTR_0015s13180.12e-84(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23313280
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.13e-73myb domain protein 17